PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA036334-PA
Common NameOsI_38061
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family M-type_MADS
Protein Properties Length: 141aa    MW: 15383.8 Da    PI: 10.4076
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA036334-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF56.34.1e-182572249
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
            SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                       i+nk + qvtf+kR  g++KKA+EL  L +a +av+ifs+t+  y +
  BGIOSGA036334-PA 25 HIDNKERWQVTFTKRWGGLFKKASELALLAGASIAVVIFSETNLAYAF 72
                      69****************************************998877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.0E-141675IPR002100Transcription factor, MADS-box
PRINTSPR004048.3E-111838IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.7732476IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.19E-182490IPR002100Transcription factor, MADS-box
PfamPF003197.3E-182672IPR002100Transcription factor, MADS-box
PRINTSPR004048.3E-113853IPR002100Transcription factor, MADS-box
PRINTSPR004048.3E-115374IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 141 aa     Download sequence    Send to blast
MMSTVRQQGV QSWLQFVRVL TGRQHIDNKE RWQVTFTKRW GGLFKKASEL ALLAGASIAV  60
VIFSETNLAY AFGDPSVDAV LLSYGPVPGE DAEPAPVHSG GLSKDVDLKM LRQAVGETRA  120
EVAAEKARMR GVTTKILRAK A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL7139421e-172AL713942.4 Oryza sativa chromosome 12, . BAC OSJNBa0009F05 of library OSJNBa from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAP0149681e-172AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619812.13e-58PREDICTED: agamous-like MADS-box protein AGL62
SwissprotQ9FKK23e-15AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBLA2ZJR61e-100A2ZJR6_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA036334-PA2e-99(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28333088
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.12e-16AGAMOUS-like 62